Lineage for d1xqcb_ (1xqc B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923994Protein automated matches [190059] (10 species)
    not a true protein
  7. 924007Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)
  8. 924065Domain d1xqcb_: 1xqc B: [122234]
    automated match to d1qkua_
    complexed with aej

Details for d1xqcb_

PDB Entry: 1xqc (more details), 2.05 Å

PDB Description: X-ray structure of ERalpha LBD bound to a tetrahydroisoquinoline SERM ligand at 2.05A resolution
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d1xqcb_:

Sequence, based on SEQRES records: (download)

>d1xqcb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemlda
hr

Sequence, based on observed residues (ATOM records): (download)

>d1xqcb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
qqhqrlaqlllilshirhmsnkgmehlplydlllemldahr

SCOPe Domain Coordinates for d1xqcb_:

Click to download the PDB-style file with coordinates for d1xqcb_.
(The format of our PDB-style files is described here.)

Timeline for d1xqcb_: