Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Viral cyclin [47961] (3 species) |
Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) |
Domain d1xo2a2: 1xo2 A:149-254 [122199] Other proteins in same PDB: d1xo2b_ automated match to d1jowa2 complexed with fse |
PDB Entry: 1xo2 (more details), 2.9 Å
SCOPe Domain Sequences for d1xo2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xo2a2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil
Timeline for d1xo2a2: