Lineage for d1xo2a2 (1xo2 A:149-254)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718531Protein Viral cyclin [47961] (3 species)
  7. 2718532Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)
  8. 2718538Domain d1xo2a2: 1xo2 A:149-254 [122199]
    Other proteins in same PDB: d1xo2b_
    automated match to d1jowa2
    complexed with fse

Details for d1xo2a2

PDB Entry: 1xo2 (more details), 2.9 Å

PDB Description: Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin
PDB Compounds: (A:) Cyclin

SCOPe Domain Sequences for d1xo2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo2a2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil

SCOPe Domain Coordinates for d1xo2a2:

Click to download the PDB-style file with coordinates for d1xo2a2.
(The format of our PDB-style files is described here.)

Timeline for d1xo2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xo2a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xo2b_