Lineage for d1xnna1 (1xnn A:672-918)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776485Protein Androgen receptor [63621] (3 species)
  7. 776532Species Rat (Rattus norvegicus) [TaxId:10116] [63622] (7 PDB entries)
  8. 776538Domain d1xnna1: 1xnn A:672-918 [122197]
    automatically matched to d1i38a_
    complexed with hyq; mutant

Details for d1xnna1

PDB Entry: 1xnn (more details), 2.2 Å

PDB Description: crystal structure of the rat androgen receptor ligand binding domain t877a mutant complex with (3a-alpha-,4-alpha 7-alpha-,7a-alpha-)-3a, 4,7,7a-tetrahydro-2-(4-nitro-1-naphthalenyl)-4,7-ethano-1h-isoindole- 1,3(2h)-dione.
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d1xnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnna1 a.123.1.1 (A:672-918) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfht

SCOP Domain Coordinates for d1xnna1:

Click to download the PDB-style file with coordinates for d1xnna1.
(The format of our PDB-style files is described here.)

Timeline for d1xnna1: