SCOPe 2.05: Domain d1xnjb2: 1xnj B:390-623

Lineage for d1xnjb2 (1xnj B:390-623)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
   automatically mapped to Pfam PF01747

6. Protein ATP sulfurylase catalytic domain [63980] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries)
   Uniprot O43252 390-624

8. Domain d1xnjb2: 1xnj B:390-623 [122193]
   Other proteins in same PDB: d1xnja1, d1xnja3, d1xnjb1, d1xnjb3
   automated match to d1x6va2
   complexed with adp, adx

Details for d1xnjb2

PDB Entry: 1xnj, 1.98 Å

PDB Description: aps complex of human paps synthetase 1

PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xnjb2:

Sequence; same for both SEQRES and ATOM records:

>d1xnjb2 c.26.1.5 (B:390-623) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl
llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra
rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk
krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyykslek

Timeline for d1xnjb2:

• d1xnjb2 first appeared in SCOP 1.73
  
• d1xnjb2 appears in SCOPe 2.04
  
• d1xnjb2 appears in SCOPe 2.06
  
• d1xnjb2 appears in the current release, SCOPe 2.08