SCOPe 2.07: Domain d1xmhf_: 1xmh F:

Lineage for d1xmhf_ (1xmh F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1xmhf_: 1xmh F: [122164]
   Other proteins in same PDB: d1xmha_, d1xmhb_, d1xmhc_, d1xmhd_
   automated match to d1fyzf_
   complexed with co

Details for d1xmhf_

PDB Entry: 1xmh, 2.32 Å

PDB Description: Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath)

PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xmhf_:

Sequence; same for both SEQRES and ATOM records:

>d1xmhf_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1xmhf_:

• d1xmhf_ first appeared in SCOP 1.73, called d1xmhf1
  
• d1xmhf_ appears in SCOPe 2.06
  
• d1xmhf_ appears in the current release, SCOPe 2.08