SCOPe 2.03: Domain d1xmhd_: 1xmh D:

Lineage for d1xmhd_ (1xmh D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1xmhd_: 1xmh D: [122162]
   Other proteins in same PDB: d1xmha_, d1xmhb_, d1xmhe_, d1xmhf_
   automated match to d1fyzc_
   complexed with co

Details for d1xmhd_

PDB Entry: 1xmh, 2.32 Å

PDB Description: Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath)

PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xmhd_:

Sequence; same for both SEQRES and ATOM records:

>d1xmhd_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaevilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1xmhd_:

• d1xmhd_ first appeared in SCOP 1.73, called d1xmhd1
  
• d1xmhd_ appears in SCOPe 2.02
  
• d1xmhd_ appears in SCOPe 2.04
  
• d1xmhd_ appears in the current release, SCOPe 2.08