Lineage for d1xmhc1 (1xmh C:2-389)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639129Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 639130Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 639165Domain d1xmhc1: 1xmh C:2-389 [122161]
    Other proteins in same PDB: d1xmhe1, d1xmhf1
    automatically matched to 1XMF C:2-389
    complexed with co

Details for d1xmhc1

PDB Entry: 1xmh (more details), 2.32 Å

PDB Description: Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath)
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOP Domain Sequences for d1xmhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmhc1 a.25.1.2 (C:2-389) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaevilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1xmhc1:

Click to download the PDB-style file with coordinates for d1xmhc1.
(The format of our PDB-style files is described here.)

Timeline for d1xmhc1: