Lineage for d1xmge1 (1xmg E:3-168)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765254Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 765285Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 765286Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 765287Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 765288Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 765319Domain d1xmge1: 1xmg E:3-168 [122157]
    Other proteins in same PDB: d1xmga1, d1xmgb1, d1xmgc1, d1xmgd1
    automatically matched to d1fyzf_
    complexed with ca

Details for d1xmge1

PDB Entry: 1xmg (more details), 2.1 Å

PDB Description: Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath)
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xmge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmge1 a.23.3.1 (E:3-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1xmge1:

Click to download the PDB-style file with coordinates for d1xmge1.
(The format of our PDB-style files is described here.)

Timeline for d1xmge1: