SCOP 1.73: Domain d1xmge1: 1xmg E:3-168

Lineage for d1xmge1 (1xmg E:3-168)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1xmge1: 1xmg E:3-168 [122157]
   Other proteins in same PDB: d1xmga1, d1xmgb1, d1xmgc1, d1xmgd1
   automatically matched to d1fyzf_
   complexed with ca

Details for d1xmge1

PDB Entry: 1xmg, 2.1 Å

PDB Description: Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath)

PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xmge1:

Sequence; same for both SEQRES and ATOM records:

>d1xmge1 a.23.3.1 (E:3-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1xmge1:

• d1xmge1 is new in SCOP 1.73
  
• d1xmge1 appears in SCOP 1.75
  
• d1xmge1 appears in the current release, SCOPe 2.08, called d1xmge_