SCOPe 2.02: Domain d1xmgd_: 1xmg D:

Lineage for d1xmgd_ (1xmg D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1xmgd_: 1xmg D: [122156]
   Other proteins in same PDB: d1xmga1, d1xmgb1, d1xmge_, d1xmgf_
   automated match to d1fyzc_
   complexed with ca

Details for d1xmgd_

PDB Entry: 1xmg, 2.1 Å

PDB Description: Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath)

PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xmgd_:

Sequence; same for both SEQRES and ATOM records:

>d1xmgd_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaevilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1xmgd_:

• d1xmgd_ first appeared in SCOP 1.73, called d1xmgd1
  
• d1xmgd_ appears in SCOPe 2.01
  
• d1xmgd_ appears in SCOPe 2.03
  
• d1xmgd_ appears in the current release, SCOPe 2.08