Lineage for d1xmff1 (1xmf F:4-168)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765254Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 765285Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 765286Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 765287Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 765288Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 765330Domain d1xmff1: 1xmf F:4-168 [122152]
    Other proteins in same PDB: d1xmfa1, d1xmfb1, d1xmfc1, d1xmfd1
    automatically matched to d1fyzf_
    complexed with ca, mn

Details for d1xmff1

PDB Entry: 1xmf (more details), 2.32 Å

PDB Description: structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xmff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmff1 a.23.3.1 (F:4-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1xmff1:

Click to download the PDB-style file with coordinates for d1xmff1.
(The format of our PDB-style files is described here.)

Timeline for d1xmff1: