SCOPe 2.02: Domain d1xmfe_: 1xmf E:

Lineage for d1xmfe_ (1xmf E:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1xmfe_: 1xmf E: [122151]
   Other proteins in same PDB: d1xmfa1, d1xmfb1, d1xmfc1, d1xmfd_
   automated match to d1fyzf_
   complexed with ca, mn

Details for d1xmfe_

PDB Entry: 1xmf, 2.32 Å

PDB Description: structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)

PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xmfe_:

Sequence; same for both SEQRES and ATOM records:

>d1xmfe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1xmfe_:

• d1xmfe_ first appeared in SCOP 1.73, called d1xmfe1
  
• d1xmfe_ appears in SCOPe 2.01
  
• d1xmfe_ appears in SCOPe 2.03
  
• d1xmfe_ appears in the current release, SCOPe 2.08