Lineage for d1xmec_ (1xme C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025599Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 3025600Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)
  6. 3025601Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 3025602Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries)
  8. 3025608Domain d1xmec_: 1xme C: [122146]
    Other proteins in same PDB: d1xmea_, d1xmeb1, d1xmeb2
    automated match to d1xmec1
    complexed with bng, cu, cua, gol, has, hem

Details for d1xmec_

PDB Entry: 1xme (more details), 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide IIA

SCOPe Domain Sequences for d1xmec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmec_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d1xmec_:

Click to download the PDB-style file with coordinates for d1xmec_.
(The format of our PDB-style files is described here.)

Timeline for d1xmec_: