Lineage for d1xmeb2 (1xme B:3-36)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886795Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 886817Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 886818Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 886833Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 886834Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 886835Domain d1xmeb2: 1xme B:3-36 [122145]
    Other proteins in same PDB: d1xmea1, d1xmeb1, d1xmec1
    automatically matched to d1ehkb2
    complexed with bng, cu, cua, gol, has, hem

Details for d1xmeb2

PDB Entry: 1xme (more details), 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOP Domain Sequences for d1xmeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmeb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiayt

SCOP Domain Coordinates for d1xmeb2:

Click to download the PDB-style file with coordinates for d1xmeb2.
(The format of our PDB-style files is described here.)

Timeline for d1xmeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmeb1