Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (7 PDB entries) |
Domain d1xmeb1: 1xme B:37-168 [122144] Other proteins in same PDB: d1xmea1, d1xmeb2, d1xmec1 automatically matched to d2cuab_ complexed with bng, cu, cua, gol, has, hem |
PDB Entry: 1xme (more details), 2.3 Å
SCOP Domain Sequences for d1xmeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmeb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg hqnmfgtivvke
Timeline for d1xmeb1: