Lineage for d1xmeb1 (1xme B:37-168)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791487Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 791488Protein Cytochrome c oxidase [49544] (4 species)
  7. 791531Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (7 PDB entries)
  8. 791534Domain d1xmeb1: 1xme B:37-168 [122144]
    Other proteins in same PDB: d1xmea1, d1xmeb2, d1xmec1
    automatically matched to d2cuab_
    complexed with bng, cu, cua, gol, has, hem

Details for d1xmeb1

PDB Entry: 1xme (more details), 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOP Domain Sequences for d1xmeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmeb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

SCOP Domain Coordinates for d1xmeb1:

Click to download the PDB-style file with coordinates for d1xmeb1.
(The format of our PDB-style files is described here.)

Timeline for d1xmeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmeb2