SCOP 1.73: Domain d1xmeb1: 1xme B:37-168

Lineage for d1xmeb1 (1xme B:37-168)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (4 PDB entries)

8. Domain d1xmeb1: 1xme B:37-168 [122144]
   Other proteins in same PDB: d1xmea1, d1xmeb2, d1xmec1
   automatically matched to d2cuab_
   complexed with bng, cu, cua, gol, has, hem

Details for d1xmeb1

PDB Entry: 1xme, 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOP Domain Sequences for d1xmeb1:

Sequence; same for both SEQRES and ATOM records:

>d1xmeb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

Timeline for d1xmeb1:

• d1xmeb1 is new in SCOP 1.73
  
• d1xmeb1 appears in SCOP 1.75
  
• d1xmeb1 appears in the current release, SCOPe 2.08