SCOP 1.75: Domain d1xmea1: 1xme A:14-562

Lineage for d1xmea1 (1xme A:14-562)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81437] (2 PDB entries)

8. Domain d1xmea1: 1xme A:14-562 [122143]
   Other proteins in same PDB: d1xmeb1, d1xmeb2, d1xmec1
   automatically matched to d1ehka_
   complexed with bng, cu, cua, gol, has, hem

Details for d1xmea1

PDB Entry: 1xme, 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (A:) Cytochrome c oxidase polypeptide I

SCOP Domain Sequences for d1xmea1:

Sequence; same for both SEQRES and ATOM records:

>d1xmea1 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
srerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghl
npvpgwrlw

Timeline for d1xmea1:

• d1xmea1 first appeared in SCOP 1.73
  
• d1xmea1 is called d1xmea_ in SCOPe 2.01
  
• d1xmea1 appears in the current release, SCOPe 2.08, called d1xmea_