SCOPe 2.07: Domain d1xlqb_: 1xlq B:

Lineage for d1xlqb_ (1xlq B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)

8. Domain d1xlqb_: 1xlq B: [122120]
   automated match to d1oqra_
   complexed with fes

Details for d1xlqb_

PDB Entry: 1xlq, 1.45 Å

PDB Description: crystal structure of reduced c73s putidaredoxin from pseudomonas putida

PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d1xlqb_:

Sequence; same for both SEQRES and ATOM records:

>d1xlqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

Timeline for d1xlqb_:

• d1xlqb_ first appeared in SCOP 1.73, called d1xlqb1
  
• d1xlqb_ appears in SCOPe 2.06
  
• d1xlqb_ appears in the current release, SCOPe 2.08