Lineage for d1xlob_ (1xlo B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179171Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2179172Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2179224Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (19 PDB entries)
  8. 2179241Domain d1xlob_: 1xlo B: [122115]
    automated match to d1oqqa_
    complexed with fes

Details for d1xlob_

PDB Entry: 1xlo (more details), 1.84 Å

PDB Description: structure of reduced c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d1xlob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlob_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d1xlob_:

Click to download the PDB-style file with coordinates for d1xlob_.
(The format of our PDB-style files is described here.)

Timeline for d1xlob_: