Lineage for d1xloa1 (1xlo A:1-106)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717622Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 717623Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 717624Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 717667Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (12 PDB entries)
  8. 717679Domain d1xloa1: 1xlo A:1-106 [122114]
    automatically matched to d1oqqa_
    complexed with fes; mutant

Details for d1xloa1

PDB Entry: 1xlo (more details), 1.84 Å

PDB Description: structure of reduced c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
PDB Compounds: (A:) putidaredoxin

SCOP Domain Sequences for d1xloa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xloa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOP Domain Coordinates for d1xloa1:

Click to download the PDB-style file with coordinates for d1xloa1.
(The format of our PDB-style files is described here.)

Timeline for d1xloa1: