Lineage for d1xlna_ (1xln A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933834Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)
  8. 2933850Domain d1xlna_: 1xln A: [122112]
    automated match to d1oqqa_
    complexed with fes

Details for d1xlna_

PDB Entry: 1xln (more details), 2.03 Å

PDB Description: crystal structure of oxidized c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
PDB Compounds: (A:) putidaredoxin

SCOPe Domain Sequences for d1xlna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlna_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d1xlna_:

Click to download the PDB-style file with coordinates for d1xlna_.
(The format of our PDB-style files is described here.)

Timeline for d1xlna_: