Lineage for d1xkea1 (1xke A:3-124)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071341Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 2071359Protein Ran-binding protein 2 [141428] (1 species)
  7. 2071360Species Human (Homo sapiens) [TaxId:9606] [141429] (1 PDB entry)
    Uniprot P49792 2027-2154
  8. 2071361Domain d1xkea1: 1xke A:3-124 [122076]
    Other proteins in same PDB: d1xkea2, d1xkea3

Details for d1xkea1

PDB Entry: 1xke (more details)

PDB Description: solution structure of the second ran-binding domain from human ranbp2
PDB Compounds: (A:) Ran-binding protein 2

SCOPe Domain Sequences for d1xkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkea1 b.55.1.3 (A:3-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
geedekvlysqrvklfrfdaevsqwkerglgnlkilknevngklrmlmrreqvlkvcanh
witttmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpelaeefkqkfeecqrlll
di

SCOPe Domain Coordinates for d1xkea1:

Click to download the PDB-style file with coordinates for d1xkea1.
(The format of our PDB-style files is described here.)

Timeline for d1xkea1: