Lineage for d1xkea1 (1xke A:7-124)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799190Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 1799208Protein Ran-binding protein 2 [141428] (1 species)
  7. 1799209Species Human (Homo sapiens) [TaxId:9606] [141429] (1 PDB entry)
    Uniprot P49792 2027-2154
  8. 1799210Domain d1xkea1: 1xke A:7-124 [122076]

Details for d1xkea1

PDB Entry: 1xke (more details)

PDB Description: Solution structure of the second Ran-binding domain from human RanBP2
PDB Compounds: (A:) Ran-binding protein 2

SCOPe Domain Sequences for d1xkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
ekvlysqrvklfrfdaevsqwkerglgnlkilknevngklrmlmrreqvlkvcanhwitt
tmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpelaeefkqkfeecqrllldi

SCOPe Domain Coordinates for d1xkea1:

Click to download the PDB-style file with coordinates for d1xkea1.
(The format of our PDB-style files is described here.)

Timeline for d1xkea1: