Lineage for d1xk4k_ (1xk4 K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997730Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1997731Protein automated matches [190513] (30 species)
    not a true protein
  7. 1997781Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)
  8. 1997789Domain d1xk4k_: 1xk4 K: [122065]
    Other proteins in same PDB: d1xk4a1, d1xk4b_, d1xk4e_, d1xk4f_, d1xk4i_, d1xk4j_
    automated match to d3nxaa_
    complexed with ca, cl, flc

Details for d1xk4k_

PDB Entry: 1xk4 (more details), 1.8 Å

PDB Description: Crystal structure of human calprotectin(S100A8/S100A9)
PDB Compounds: (K:) Calgranulin B

SCOPe Domain Sequences for d1xk4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk4k_ a.39.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarltwashekmh

SCOPe Domain Coordinates for d1xk4k_:

Click to download the PDB-style file with coordinates for d1xk4k_.
(The format of our PDB-style files is described here.)

Timeline for d1xk4k_: