SCOPe 2.01: Domain d1xk1b_: 1xk1 B:

Lineage for d1xk1b_ (1xk1 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (23 PDB entries)
   Uniprot P09601

8. Domain d1xk1b_: 1xk1 B: [122054]
   automated match to d1ni6c_
   complexed with hem; mutant

Details for d1xk1b_

PDB Entry: 1xk1, 2.08 Å

PDB Description: crystal structures of the g139a, g139a-no and g143h mutants of human heme oxygenase-1

PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1xk1b_:

Sequence; same for both SEQRES and ATOM records:

>d1xk1b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1xk1b_:

• d1xk1b_ first appeared in SCOP 1.73, called d1xk1b1
  
• d1xk1b_ was called d1xk1b1 in SCOP 1.75
  
• d1xk1b_ appears in SCOPe 2.02
  
• d1xk1b_ appears in the current release, SCOPe 2.08