Lineage for d1xk1b1 (1xk1 B:10-223)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777800Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 777801Species Human (Homo sapiens) [TaxId:9606] [48616] (20 PDB entries)
    Uniprot P09601
  8. 777839Domain d1xk1b1: 1xk1 B:10-223 [122054]
    automatically matched to 1XK1 A:10-223
    complexed with hem; mutant

Details for d1xk1b1

PDB Entry: 1xk1 (more details), 2.08 Å

PDB Description: Crystal Structures of the G139A, G139A-NO and G143H Mutants of Human Heme Oxygenase-1
PDB Compounds: (B:) Heme oxygenase 1

SCOP Domain Sequences for d1xk1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk1b1 a.132.1.1 (B:10-223) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1xk1b1:

Click to download the PDB-style file with coordinates for d1xk1b1.
(The format of our PDB-style files is described here.)

Timeline for d1xk1b1: