Lineage for d1xjzb_ (1xjz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732665Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. 2732679Domain d1xjzb_: 1xjz B: [122050]
    automated match to d1ni6c_
    complexed with hem; mutant

Details for d1xjzb_

PDB Entry: 1xjz (more details), 1.88 Å

PDB Description: crystal structures of the g139a, g139a-no and g143h mutants of human heme oxygenase-1
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1xjzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjzb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytryladlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1xjzb_:

Click to download the PDB-style file with coordinates for d1xjzb_.
(The format of our PDB-style files is described here.)

Timeline for d1xjzb_: