SCOP 1.73: Domain d1xjqb3: 1xjq B:34-228

Lineage for d1xjqb3 (1xjq B:34-228)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (1 protein)

6. Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142215] (3 PDB entries)

8. Domain d1xjqb3: 1xjq B:34-228 [122040]
   Other proteins in same PDB: d1xjqa1, d1xjqa2, d1xjqb1, d1xjqb2
   automatically matched to 1X6V A:34-228
   complexed with adp

Details for d1xjqb3

PDB Entry: 1xjq, 2.06 Å

PDB Description: adp complex of human paps synthetase 1

PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1

SCOP Domain Sequences for d1xjqb3:

Sequence; same for both SEQRES and ATOM records:

>d1xjqb3 c.37.1.4 (B:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
qqvvellqerdivpv

Timeline for d1xjqb3:

• d1xjqb3 is new in SCOP 1.73
  
• d1xjqb3 appears in SCOP 1.75
  
• d1xjqb3 appears in the current release, SCOPe 2.08