Lineage for d1xjqa3 (1xjq A:34-228)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987522Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (1 protein)
  6. 987523Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 987535Species Human (Homo sapiens) [TaxId:9606] [142215] (3 PDB entries)
    Uniprot O43252 34-228
  8. 987540Domain d1xjqa3: 1xjq A:34-228 [122037]
    Other proteins in same PDB: d1xjqa1, d1xjqa2, d1xjqb1, d1xjqb2
    automatically matched to 1X6V A:34-228
    complexed with adp

Details for d1xjqa3

PDB Entry: 1xjq (more details), 2.06 Å

PDB Description: adp complex of human paps synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xjqa3:

Sequence, based on SEQRES records: (download)

>d1xjqa3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
qqvvellqerdivpv

Sequence, based on observed residues (ATOM records): (download)

>d1xjqa3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdapleyekpeapelvlktdscdvndcvqqvvellqerdivpv

SCOPe Domain Coordinates for d1xjqa3:

Click to download the PDB-style file with coordinates for d1xjqa3.
(The format of our PDB-style files is described here.)

Timeline for d1xjqa3: