SCOP 1.73: Domain d1xjqa1: 1xjq A:229-389

Lineage for d1xjqa1 (1xjq A:229-389)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
   contains extra structures; some similarity to the PK beta-barrel domain

6. Protein ATP sulfurylase N-terminal domain [63802] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141702] (3 PDB entries)

8. Domain d1xjqa1: 1xjq A:229-389 [122035]
   Other proteins in same PDB: d1xjqa2, d1xjqa3, d1xjqb2, d1xjqb3
   automatically matched to 1X6V A:229-389
   complexed with adp

Details for d1xjqa1

PDB Entry: 1xjq, 2.06 Å

PDB Description: adp complex of human paps synthetase 1

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1

SCOP Domain Sequences for d1xjqa1:

Sequence; same for both SEQRES and ATOM records:

>d1xjqa1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereyl
qclhfdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrk
eercarqwgttcknhpyikmvmeqgdwliggdlqvldrvyw

Timeline for d1xjqa1:

• d1xjqa1 is new in SCOP 1.73
  
• d1xjqa1 appears in SCOP 1.75
  
• d1xjqa1 appears in the current release, SCOPe 2.08