SCOPe 2.05: Domain d1xhmb_: 1xhm B:

Lineage for d1xhmb_ (1xhm B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries)

8. Domain d1xhmb_: 1xhm B: [122006]
   Other proteins in same PDB: d1xhma_
   automated match to d1omwg_

Details for d1xhmb_

PDB Entry: 1xhm, 2.7 Å

PDB Description: The Crystal Structure of a Biologically Active Peptide (SIGK) Bound to a G Protein Beta:Gamma Heterodimer

PDB Compounds: (B:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOPe Domain Sequences for d1xhmb_:

Sequence; same for both SEQRES and ATOM records:

>d1xhmb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
asiaqarklveqlkmeanidrikvskaaadlmayceahakedpllt

Timeline for d1xhmb_:

• d1xhmb_ first appeared in SCOP 1.73, called d1xhmb1
  
• d1xhmb_ appears in SCOPe 2.04
  
• d1xhmb_ appears in SCOPe 2.06
  
• d1xhmb_ appears in the current release, SCOPe 2.08