Lineage for d1xhmb_ (1xhm B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925761Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 925855Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 925856Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 925857Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 925858Species Cow (Bos taurus) [TaxId:9913] [48673] (17 PDB entries)
  8. 925872Domain d1xhmb_: 1xhm B: [122006]
    Other proteins in same PDB: d1xhma_
    automated match to d1omwg_

Details for d1xhmb_

PDB Entry: 1xhm (more details), 2.7 Å

PDB Description: The Crystal Structure of a Biologically Active Peptide (SIGK) Bound to a G Protein Beta:Gamma Heterodimer
PDB Compounds: (B:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOPe Domain Sequences for d1xhmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhmb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
asiaqarklveqlkmeanidrikvskaaadlmayceahakedpllt

SCOPe Domain Coordinates for d1xhmb_:

Click to download the PDB-style file with coordinates for d1xhmb_.
(The format of our PDB-style files is described here.)

Timeline for d1xhmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xhma_