Lineage for d1xhmb1 (1xhm B:8-52)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778426Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 778427Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 778428Protein Transducin (heterotrimeric G protein), gamma chain [48672] (2 species)
  7. 778429Species Cow (Bos taurus) [TaxId:9913] [48673] (11 PDB entries)
  8. 778441Domain d1xhmb1: 1xhm B:8-52 [122006]
    Other proteins in same PDB: d1xhma1
    automatically matched to d1gg2g_

Details for d1xhmb1

PDB Entry: 1xhm (more details), 2.7 Å

PDB Description: The Crystal Structure of a Biologically Active Peptide (SIGK) Bound to a G Protein Beta:Gamma Heterodimer
PDB Compounds: (B:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOP Domain Sequences for d1xhmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhmb1 a.137.3.1 (B:8-52) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedpllt

SCOP Domain Coordinates for d1xhmb1:

Click to download the PDB-style file with coordinates for d1xhmb1.
(The format of our PDB-style files is described here.)

Timeline for d1xhmb1: