Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries) |
Domain d1xh1a1: 1xh1 A:409-496 [121991] Other proteins in same PDB: d1xh1a2 automated match to d1jxka1 complexed with ca, cl, nag |
PDB Entry: 1xh1 (more details), 2.03 Å
SCOPe Domain Sequences for d1xh1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xh1a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]} wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy vsddgkahfsisnsaedpfiaihaeskl
Timeline for d1xh1a1: