SCOP 1.75: Domain d1xgjb1: 1xgj B:4-361

Lineage for d1xgjb1 (1xgj B:4-361)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (46 PDB entries)

8. Domain d1xgjb1: 1xgj B:4-361 [121979]
   automatically matched to d1c3ba_
   complexed with htc

Details for d1xgjb1

PDB Entry: 1xgj, 1.97 Å

PDB Description: AmpC beta-lactamase in complex with 3-(4-carboxy-2-hydroxy-phenylsulfamoyl)-thiophene-2-carboxylic acid

PDB Compounds: (B:) Beta-lactamase

SCOP Domain Sequences for d1xgjb1:

Sequence; same for both SEQRES and ATOM records:

>d1xgjb1 e.3.1.1 (B:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1xgjb1:

• d1xgjb1 first appeared in SCOP 1.73
  
• d1xgjb1 is called d1xgjb_ in SCOPe 2.01
  
• d1xgjb1 appears in the current release, SCOPe 2.08, called d1xgjb_