SCOPe 2.07: Domain d1xgib_: 1xgi B:

Lineage for d1xgib_ (1xgi B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)

8. Domain d1xgib_: 1xgi B: [121977]
   automated match to d1c3ba_
   complexed with nst

Details for d1xgib_

PDB Entry: 1xgi, 1.96 Å

PDB Description: AmpC beta-lactamase in complex with 3-(3-nitro-phenylsulfamoyl)-thiophene-2-carboxylic acid

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1xgib_:

Sequence; same for both SEQRES and ATOM records:

>d1xgib_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1xgib_:

• d1xgib_ first appeared in SCOP 1.73, called d1xgib1
  
• d1xgib_ appears in SCOPe 2.06
  
• d1xgib_ appears in the current release, SCOPe 2.08