Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (11 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (48 PDB entries) Uniprot P02593 |
Domain d1xfzp1: 1xfz P:3-75 [121968] automatically matched to d1ak8__ complexed with ca, mg |
PDB Entry: 1xfz (more details), 3.25 Å
SCOPe Domain Sequences for d1xfzp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfzp1 a.39.1.5 (P:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt idfpefltmmark
Timeline for d1xfzp1: