SCOPe 2.02: Domain d1xfzp1: 1xfz P:3-75

Lineage for d1xfzp1 (1xfz P:3-75)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (11 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47517] (48 PDB entries)
   Uniprot P02593

8. Domain d1xfzp1: 1xfz P:3-75 [121968]
   automatically matched to d1ak8__
   complexed with ca, mg

Details for d1xfzp1

PDB Entry: 1xfz, 3.25 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 1 millimolar exogenously added calcium chloride

PDB Compounds: (P:) Calmodulin 2

SCOPe Domain Sequences for d1xfzp1:

Sequence; same for both SEQRES and ATOM records:

>d1xfzp1 a.39.1.5 (P:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

Timeline for d1xfzp1:

• d1xfzp1 first appeared in SCOP 1.73
  
• d1xfzp1 appears in SCOPe 2.01
  
• d1xfzp1 appears in SCOPe 2.03
  
• d1xfzp1 appears in the current release, SCOPe 2.08