Lineage for d1xfys1 (1xfy S:3-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1996875Protein Calmodulin [47516] (12 species)
  7. 1996964Species Human (Homo sapiens) [TaxId:9606] [47517] (88 PDB entries)
    Uniprot P02593
  8. 1997088Domain d1xfys1: 1xfy S:3-75 [121965]
    automatically matched to d1ak8__
    complexed with ca, mg

Details for d1xfys1

PDB Entry: 1xfy (more details), 3.3 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin
PDB Compounds: (S:) Calmodulin 2

SCOPe Domain Sequences for d1xfys1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfys1 a.39.1.5 (S:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d1xfys1:

Click to download the PDB-style file with coordinates for d1xfys1.
(The format of our PDB-style files is described here.)

Timeline for d1xfys1: