Lineage for d1xfwt1 (1xfw T:3-75)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1733853Protein Calmodulin [47516] (12 species)
  7. 1733935Species Human (Homo sapiens) [TaxId:9606] [47517] (81 PDB entries)
    Uniprot P02593
  8. 1734059Domain d1xfwt1: 1xfw T:3-75 [121954]
    automatically matched to d1ak8__
    complexed with ca, cmp, mg

Details for d1xfwt1

PDB Entry: 1xfw (more details), 3.4 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3'5' cyclic amp (camp)
PDB Compounds: (T:) Calmodulin 2

SCOPe Domain Sequences for d1xfwt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfwt1 a.39.1.5 (T:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d1xfwt1:

Click to download the PDB-style file with coordinates for d1xfwt1.
(The format of our PDB-style files is described here.)

Timeline for d1xfwt1: