Lineage for d1xfta1 (1xft A:1-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2925540Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 2925555Domain d1xfta1: 1xft A:1-128 [121936]
    automatically matched to d135l__

Details for d1xfta1

PDB Entry: 1xft (more details)

PDB Description: synchrotron x-ray powder diffraction study of hexagonal turkey egg- white lysozyme
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1xfta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfta1 d.2.1.2 (A:1-128) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcr

SCOPe Domain Coordinates for d1xfta1:

Click to download the PDB-style file with coordinates for d1xfta1.
(The format of our PDB-style files is described here.)

Timeline for d1xfta1: