Lineage for d1xdfb1 (1xdf B:1-157)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872734Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)
  6. 872762Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 872768Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (3 PDB entries)
  8. 872771Domain d1xdfb1: 1xdf B:1-157 [121869]
    automatically matched to 1XDF A:1-157
    complexed with epe, na

Details for d1xdfb1

PDB Entry: 1xdf (more details), 1.9 Å

PDB Description: Crystal structure of pathogenesis-related protein LlPR-10.2A from yellow lupine
PDB Compounds: (B:) pr10.2a

SCOP Domain Sequences for d1xdfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdfb1 d.129.3.1 (B:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfedeststiaparlykalvkdadaiipkaveaiqsietvegnggpgtikkltlieg
getkyvlhkieavdeanlrynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaienylsahpeyn

SCOP Domain Coordinates for d1xdfb1:

Click to download the PDB-style file with coordinates for d1xdfb1.
(The format of our PDB-style files is described here.)

Timeline for d1xdfb1: