Lineage for d1xdfa1 (1xdf A:1-157)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733463Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)
  6. 733491Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 733497Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (3 PDB entries)
  8. 733499Domain d1xdfa1: 1xdf A:1-157 [121868]
    isoform llpr10.2a
    complexed with epe, na

Details for d1xdfa1

PDB Entry: 1xdf (more details), 1.9 Å

PDB Description: Crystal structure of pathogenesis-related protein LlPR-10.2A from yellow lupine
PDB Compounds: (A:) pr10.2a

SCOP Domain Sequences for d1xdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfedeststiaparlykalvkdadaiipkaveaiqsietvegnggpgtikkltlieg
getkyvlhkieavdeanlrynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaienylsahpeyn

SCOP Domain Coordinates for d1xdfa1:

Click to download the PDB-style file with coordinates for d1xdfa1.
(The format of our PDB-style files is described here.)

Timeline for d1xdfa1: