Lineage for d1xc8a2 (1xc8 A:2-131)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679457Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 679458Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 679459Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 679460Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 679476Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries)
  8. 679479Domain d1xc8a2: 1xc8 A:2-131 [121853]
    Other proteins in same PDB: d1xc8a1, d1xc8a3
    automatically matched to d1kfva2
    complexed with fox, gol, zn

Details for d1xc8a2

PDB Entry: 1xc8 (more details), 1.95 Å

PDB Description: crystal structure complex between the wild-type lactococcus lactis fpg (mutm) and a fapy-dg containing dna
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOP Domain Sequences for d1xc8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc8a2 b.113.1.1 (A:2-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
elpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkylif
eigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistdq
vlpyflkkki

SCOP Domain Coordinates for d1xc8a2:

Click to download the PDB-style file with coordinates for d1xc8a2.
(The format of our PDB-style files is described here.)

Timeline for d1xc8a2: