Lineage for d1x7jb1 (1x7j B:263-497)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776613Protein Estrogen receptor beta [48521] (2 species)
  7. 776614Species Human (Homo sapiens) [TaxId:9606] [48522] (19 PDB entries)
  8. 776627Domain d1x7jb1: 1x7j B:263-497 [121789]
    automatically matched to d1l2jb_
    complexed with gen

Details for d1x7jb1

PDB Entry: 1x7j (more details), 2.3 Å

PDB Description: crystal structure of estrogen receptor beta complexed with genistein
PDB Compounds: (B:) Estrogen receptor beta

SCOP Domain Sequences for d1x7jb1:

Sequence, based on SEQRES records: (download)

>d1x7jb1 a.123.1.1 (B:263-497) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna

Sequence, based on observed residues (ATOM records): (download)

>d1x7jb1 a.123.1.1 (B:263-497) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna

SCOP Domain Coordinates for d1x7jb1:

Click to download the PDB-style file with coordinates for d1x7jb1.
(The format of our PDB-style files is described here.)

Timeline for d1x7jb1: