![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Factor IX (IXa) [57198] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
![]() | Domain d1x7al1: 1x7a L:50-86 [121782] Other proteins in same PDB: d1x7ac1 automatically matched to d1pfxl1 complexed with 187 |
PDB Entry: 1x7a (more details), 2.9 Å
SCOP Domain Sequences for d1x7al1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7al1 g.3.11.1 (L:50-86) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} qcepnpclngglckddinsyecwcqvgfegkncelda
Timeline for d1x7al1: