Lineage for d1x6ya1 (1x6y A:25-144)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720355Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 720356Superfamily d.24.1: Pili subunits [54523] (4 families) (S)
    bacterial filament proteins
  5. 720357Family d.24.1.1: Pilin [54524] (4 proteins)
  6. 720369Protein Type IV Pilin Pak [109620] (1 species)
  7. 720370Species Pseudomonas aeruginosa [TaxId:287] [54527] (8 PDB entries)
  8. 720374Domain d1x6ya1: 1x6y A:25-144 [121762]
    automatically matched to d1dzoa_

Details for d1x6ya1

PDB Entry: 1x6y (more details), 1.55 Å

PDB Description: structure 6: room temperature crystal structure of the truncated pak pilin from pseudomonas aeruginosa at 1.80a resolution
PDB Compounds: (A:) fimbrial protein

SCOP Domain Sequences for d1x6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6ya1 d.24.1.1 (A:25-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOP Domain Coordinates for d1x6ya1:

Click to download the PDB-style file with coordinates for d1x6ya1.
(The format of our PDB-style files is described here.)

Timeline for d1x6ya1: