SCOP 1.73: Domain d1x5oa1: 1x5o A:8-108

Lineage for d1x5oa1 (1x5o A:8-108)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein RNA-binding motif, single-stranded-interacting protein 1, RBMS1 [143356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143357] (1 PDB entry)

8. Domain d1x5oa1: 1x5o A:8-108 [121715]

Details for d1x5oa1

PDB Entry: 1x5o

PDB Description: solution structure of rrm domain in rna binding motif, single-stranded interacting protein 1

PDB Compounds: (A:) RNA binding motif, single-stranded interacting protein 1

SCOP Domain Sequences for d1x5oa1:

Sequence; same for both SEQRES and ATOM records:

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}
lkasgvqaqmakqqeqdptnlyisnlplsmdeqelenmlkpfgqvistrilrdssgtsrg
vgfarmestekceavighfngkfiktppgvsaptepllckf

Timeline for d1x5oa1:

• d1x5oa1 is new in SCOP 1.73
  
• d1x5oa1 appears in SCOP 1.75
  
• d1x5oa1 appears in the current release, SCOPe 2.08