Lineage for d1x4ya1 (1x4y A:8-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767527Protein Brother of CDO precursor (BOC) [141037] (1 species)
  7. 1767528Species Mouse (Mus musculus) [TaxId:10090] [141038] (2 PDB entries)
    Uniprot Q6AZB0 591-689! Uniprot Q6AZB0 707-807
  8. 1767530Domain d1x4ya1: 1x4y A:8-108 [121700]

Details for d1x4ya1

PDB Entry: 1x4y (more details)

PDB Description: solution structure of the 3rd fibronectin type iii domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (cdon) binding protein
PDB Compounds: (A:) biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon)binding protein

SCOPe Domain Sequences for d1x4ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}
pvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkdmvegd
rywhsishlqpetsydikmqcfneggesefsnvmicetkar

SCOPe Domain Coordinates for d1x4ya1:

Click to download the PDB-style file with coordinates for d1x4ya1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ya1: