Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
Protein Brother of CDO precursor (BOC) [141037] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141038] (2 PDB entries) |
Domain d1x4ya1: 1x4y A:8-108 [121700] |
PDB Entry: 1x4y (more details)
SCOP Domain Sequences for d1x4ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} pvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkdmvegd rywhsishlqpetsydikmqcfneggesefsnvmicetkar
Timeline for d1x4ya1: