Lineage for d1x4fa1 (1x4f A:8-106)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028064Protein Matrin 3 [143306] (1 species)
  7. 1028065Species Mouse (Mus musculus) [TaxId:10090] [143307] (2 PDB entries)
    Uniprot Q8K310 390-478! Uniprot Q8K310 478-576
  8. 1028067Domain d1x4fa1: 1x4f A:8-106 [121688]
    2nd RBD

Details for d1x4fa1

PDB Entry: 1x4f (more details)

PDB Description: solution structure of the second rrm domain in matrin 3
PDB Compounds: (A:) Matrin 3

SCOPe Domain Sequences for d1x4fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}
kkpegkpdqkfdqkqelgrvihlsnlphsgysdsavlklaepygkiknyilmrmksqafi
emetredamamvdhclkkalwfqgrcvkvdlsekykklv

SCOPe Domain Coordinates for d1x4fa1:

Click to download the PDB-style file with coordinates for d1x4fa1.
(The format of our PDB-style files is described here.)

Timeline for d1x4fa1: